PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.A02928.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 255aa    MW: 28885.9 Da    PI: 8.7809
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.A02928.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.18.7e-32958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gklye+ 
  Pahal.A02928.1  9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFG 58
                    79**********************************************95 PP

2K-box104.61.3e-3478171699
           K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                     +++ + ++++s++qe++kL+++ e Lqr+qRhllGedL++Ls+keLqqLe+qLe +l++ R++K++l++eq+eel++ke+ l e n++L++kle
  Pahal.A02928.1  78 DSNGALSETQSWYQEMSKLRAKFEALQRTQRHLLGEDLGPLSVKELQQLEKQLECALSQARQRKTQLMMEQVEELRRKERHLGEMNRQLKHKLE 171
                     344466788***********************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.571161IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-41160IPR002100Transcription factor, MADS-box
CDDcd002654.32E-46278No hitNo description
SuperFamilySSF554553.53E-33277IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.1E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-333859IPR002100Transcription factor, MADS-box
PfamPF014861.2E-3085170IPR002487Transcription factor, K-box
PROSITE profilePS5129717.8886176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009553Biological Processembryo sac development
GO:0009911Biological Processpositive regulation of flower development
GO:0010094Biological Processspecification of carpel identity
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048455Biological Processstamen formation
GO:0048459Biological Processfloral whorl structural organization
GO:0048509Biological Processregulation of meristem development
GO:0048833Biological Processspecification of floral organ number
GO:0080060Biological Processintegument development
GO:0080112Biological Processseed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVALIIFSS RGKLYEFGSA  60
GITKTLERYQ HCCYNAQDSN GALSETQSWY QEMSKLRAKF EALQRTQRHL LGEDLGPLSV  120
KELQQLEKQL ECALSQARQR KTQLMMEQVE ELRRKERHLG EMNRQLKHKL EAEGCSNYRT  180
LQHAAAWPAP GGTIVEHDGA TYHVHPPAHS AAMDCEPTLQ IGYPQHQFLP SEAANNIPRS  240
APGGENNFML GWVL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_D1e-227917410104Developmental protein SEPALLATA 3
4ox0_C1e-227917410104Developmental protein SEPALLATA 3
4ox0_B1e-227917410104Developmental protein SEPALLATA 3
4ox0_A1e-227917410104Developmental protein SEPALLATA 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00315DAPTransfer from AT2G45650Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0877510.0BT087751.1 Zea mays full-length cDNA clone ZM_BFb0184N10 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953459.10.0PREDICTED: MADS-box transcription factor 6
SwissprotQ6EU391e-152MADS6_ORYSJ; MADS-box transcription factor 6
TrEMBLK3YV640.0K3YV64_SETIT; Uncharacterized protein
STRINGSi018160m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41873566
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.11e-102AGAMOUS-like 6